PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc002135.1_g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NAC
Protein Properties Length: 526aa    MW: 60658.1 Da    PI: 6.2016
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc002135.1_g00003.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM48.23.4e-155198250
                      NAM  2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkk 50
                             ppG+rFhP+d+el+v+yL +kv++++l++  +i++v+ y+++PwdLp++
  Itr_sc002135.1_g00003.1 51 PPGVRFHPSDQELIVYYLFNKVNSHPLPA-CIITDVEFYNYNPWDLPSN 98
                             9**************************99.78**************953 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.05E-164399IPR003441NAC domain
PROSITE profilePS5100511.7150261IPR003441NAC domain
PfamPF023655.0E-65192IPR003441NAC domain
Gene3DG3DSA:3.80.10.107.2E-22109402IPR032675Leucine-rich repeat domain, L domain-like
SuperFamilySSF813832.75E-10110166IPR001810F-box domain
PfamPF006461.0E-4113150IPR001810F-box domain
SuperFamilySSF520471.26E-16195405No hitNo description
SMARTSM005791.0E-4451521IPR006566FBD domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 526 aa     Download sequence    Send to blast
MPSLGMVTGW SPSPSLPEMA TNWSPSPAVN WRRRPVGRHP HRAAISSFHF PPGVRFHPSD  60
QELIVYYLFN KVNSHPLPAC IITDVEFYNY NPWDLPSNLM AQPQIVADAS RDLISHLPAE  120
IKDRILECLP TLDAARTALL STHWNDAWLR HGRLAFDFNF FWHFRESKGY TLLPFVQIIT  180
RILLQRVQPV KKFSLVIPSL ESLDPKLEQS DLDQWFDFLS RNGVEELRIS NGGNVTPYKL  240
PFCIVSCPTI KQLRLCKVYF DFPPNAPCIF PCVTSLEFLD VSFAHNVNGI VYSIPNLEKL  300
DLSNCRWISN FKISAPKLES LSITGCRYEF GFICKFESSW FALHLRAIKN WRDAVVASFP  360
TAINLQVLKL HSFEFAREKH LKGVLQLLQK SPNLCELEIT GYDEIEEDDD MEDDDDMEDD  420
DMEDDFMEDY DIEAASRLLK DPESCIINQD LKVLKTIKIK LFCRSPVEMM FMKMLLSKSP  480
ILERVVITEY RYIKDGCTVI KFLRELRCFP RASPKAQIVV KGKDYA
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77450.18e-15NAC domain containing protein 32